PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS61096.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB_related
Protein Properties Length: 109aa    MW: 12561.3 Da    PI: 10.2706
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS61096.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding506.9e-162064147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT+eE++++++a +++  + Wk+I  ++g  +t  q++s+ qky
       EPS61096.1 20 RESWTEEEHDKFIEALQLFERD-WKKIEDYVG-SKTVIQIRSHAQKY 64
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.71E-181470IPR009057Homeodomain-like
PROSITE profilePS5129417.2361569IPR017930Myb domain
TIGRFAMsTIGR015575.4E-191867IPR006447Myb domain, plants
SMARTSM007179.4E-121967IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-81960IPR009057Homeodomain-like
PfamPF002491.0E-132064IPR001005SANT/Myb domain
CDDcd001676.65E-102265No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0032922Biological Processcircadian regulation of gene expression
GO:0043966Biological Processhistone H3 acetylation
GO:0046686Biological Processresponse to cadmium ion
GO:0048573Biological Processphotoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 109 aa     Download sequence    Send to blast
SSGDGSAKKV RKPYTITKSR ESWTEEEHDK FIEALQLFER DWKKIEDYVG SKTVIQIRSH  60
AQKYFLKVQK NGTTAHVPPP RPKRKAAHPY PQKAPKNGLS YPADVCVYF
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00338DAPTransfer from AT3G09600Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009342304.14e-62PREDICTED: protein REVEILLE 8 isoform X3
SwissprotQ8RWU31e-61RVE8_ARATH; Protein REVEILLE 8
TrEMBLS8C9Q37e-77S8C9Q3_9LAMI; Uncharacterized protein (Fragment)
STRINGVIT_08s0040g03220.t016e-61(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9982478
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.17e-49MYB_related family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]